General Information

  • ID:  hor001893
  • Uniprot ID:  P0DJ95
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide 27
  • Gene name:  Adcyap1
  • Organism:  Heloderma suspectum (Gila monster)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0010628 positive regulation of gene expression; GO:0030073 insulin secretion; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVKKYLAAVL
  • Length:  27(24-50)
  • Propeptide:  IFNKAYRKVLGQLSARKYLHSLMHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQ
  • Signal peptide:  NA
  • Modification:  T27 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes neuron projection development
  • Mechanism:  Binding to its receptor activates G proteins and stimulates adenylate cyclase in pituitary cell
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: IC50 = 9.6???.4 nM ( PubMed ID: 18353507 )
  • EC50: 5.6???.9nM
  • ED50: NA
  • kd: NA
  • Half life: 2340 seconds ( PubMed ID: 18353507 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0DJ95-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001893_AF2.pdbhor001893_ESM.pdb

Physical Information

Mass: 361257 Formula: C142H223N39O40S
Absent amino acids: CENPW Common amino acids: AKSY
pI: 10.11 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -41.48 Boman Index: -5278
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 75.93
Instability Index: 2397.04 Extinction Coefficient cystines: 4470
Absorbance 280nm: 171.92

Literature