General Information

  • ID:  hor001884
  • Uniprot ID:  P48144
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide
  • Gene name:  NA
  • Organism:  Clarias macrocephalus (Bighead catfish)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Brain, testis, ovary and stomach. Not pancreas, pituitary, muscle and liver.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Clarias (genus), Clariidae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK
  • Length:  38(130-167)
  • Propeptide:  MAKSSRATLALLIYGILMRYSQCTPIGMGFPNMRLDNDVFGDEGNSLSELSYEPDTMSARSRPALPEDAYTLYYPPERRAETHADGLLDRALRDILVQLSARKYLHSLTAVRVGEEEEDEEDSEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNKGRRLVVPSVWTGIRDTVIITPEKRGKRY
  • Signal peptide:  MAKSSRATLALLIYGILMRY
  • Modification:  T38 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays pivotal roles as a neurotransmitter and/or a neuromodulator.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5H8A3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q5H8A3-F1.pdbhor001884_AF2.pdbhor001884_ESM.pdb

Physical Information

Mass: 532750 Formula: C207H330N68O54S
Absent amino acids: CEPW Common amino acids: R
pI: 11.56 Basic residues: 12
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -114.47 Boman Index: -14133
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 53.95
Instability Index: 4311.32 Extinction Coefficient cystines: 5960
Absorbance 280nm: 161.08

Literature

  • PubMed ID:  7758831
  • Title:  Sequence and Expression of cDNA for Pituitary Adenylate Cyclase Activating Polypeptide (PACAP) and Growth Hormone-Releasing Hormone (GHRH)-like Peptide in Catfish