General Information

  • ID:  hor001875
  • Uniprot ID:  P29794
  • Protein name:  Glucagon-like peptide 1
  • Gene name:  GCG
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity). |Glucagon is secreted in the A cells of the islets of Langerhans. GLP-
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031769 glucagon receptor binding
  • GO BP:  GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0014823 response to activity; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
  • Length:  37
  • Propeptide:  MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEEFRRRHADGSFSDEMNTVLDTLATRDFINWLLQTKITDRK
  • Signal peptide:  MKSIYFVAGLFVMLVQGSWQ
  • Modification:  T14 Phosphoserine;T17 Phosphoserine;T36 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  GLP-1 is a potent stimulator of glucose-dependent insulin release. Plays important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Has growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: <5 minutes; /300 seconds ( PubMed ID: 17283237 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01160-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P01160-F1.pdbhor001875_AF2.pdbhor001875_ESM.pdb

Physical Information

Mass: 481184 Formula: C186H275N51O59
Absent amino acids: CMNP Common amino acids: E
pI: 4.83 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 13
Hydrophobicity: -61.35 Boman Index: -7766
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 58.11
Instability Index: 1914.86 Extinction Coefficient cystines: 6990
Absorbance 280nm: 194.17

Literature

  • PubMed ID:  3238052##17283237
  • Title:  Immunoreactive Glucagons Purified From Dog Pancreas, Stomach and Ileum