General Information

  • ID:  hor001869
  • Uniprot ID:  P42692
  • Protein name:  Somatoliberin
  • Gene name:  ghrh
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS
  • Length:  45
  • Propeptide:  HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  stimulate the secretion of growth hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: 0.08 nM
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P42692-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P42692-F1.pdbhor001869_AF2.pdbhor001869_ESM.pdb

Physical Information

Mass: 576372 Formula: C215H347N65O65S3
Absent amino acids: CW Common amino acids: AGL
pI: 9.81 Basic residues: 9
Polar residues: 13 Hydrophobic residues: 13
Hydrophobicity: -61.33 Boman Index: -9059
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 69.56
Instability Index: 3962.89 Extinction Coefficient cystines: 2980
Absorbance 280nm: 67.73

Literature

  • PubMed ID:  1475012
  • Title:  Isolation and characterization of hypothalamic growth-hormone releasing factor from common carp, Cyprinus carpio.