General Information

  • ID:  hor001866
  • Uniprot ID:  A0A8C2TD01
  • Protein name:  PACAP27
  • Gene name:  ADCYAP1
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HIDGIFTDSYSRY
  • Length:  13(128-140)
  • Propeptide:  MCSKALLALLVYGIIMHCSVYCSPAVGLQYPALRLEEEVYDEDGNTLQDFAYEQEPLGVAGPPSALGEVYALYYPPGKRHADGIFSKAYRKLLGQLSARKYLHSLMAKRVGGASSGLGDEAEPLSKRHIDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRVAYL
  • Signal peptide:  MCSKALLALLVYGIIMHCSVYC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001866_AF2.pdbhor001866_ESM.pdb

Physical Information

Mass: 178790 Formula: C71H100N18O23
Absent amino acids: ACEKLMNPQVW Common amino acids: DISY
pI: 5.41 Basic residues: 2
Polar residues: 6 Hydrophobic residues: 3
Hydrophobicity: -63.08 Boman Index: -3291
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 6033.08 Extinction Coefficient cystines: 2980
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon