General Information

  • ID:  hor001826
  • Uniprot ID:  Q705J7
  • Protein name:  Leucomyosuppressin
  • Gene name:  lms
  • Organism:  Blattella germanica (German cockroach) (Blatta germanica)
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blattella (genus), Blattellinae (subfamily), Ectobiidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  QDVDHVFLRF
  • Length:  10(83-92)
  • Propeptide:  MKYVSVVLISVLAVLLACMPHMASAVPPPQCSPNILDDVPPRVRKVCAALSTIYELSNAMEAYLDDKVVRENTPLVDTGVKRQDVDHVFLRFGRRR
  • Signal peptide:  MKYVSVVLISVLAVLLACMPHMASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibited food intake;elicited a powerful myoinhibitory effect on B. germanica foregut and hindgut
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: 10(-10) M
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q705J7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001826_AF2.pdbhor001826_ESM.pdb

Physical Information

Mass: 143615 Formula: C59H86N16O16
Absent amino acids: ACEGIKMNPSTWY Common amino acids: DFV
pI: 5.41 Basic residues: 2
Polar residues: 0 Hydrophobic residues: 5
Hydrophobicity: -4 Boman Index: -2360
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 97
Instability Index: 3249 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15093704
  • Title:  Identification of Leucomyosuppressin in the German Cockroach, Blattella Germanica, as an Inhibitor of Food Intake