General Information

  • ID:  hor001801
  • Uniprot ID:  P91889
  • Protein name:  ALSGDAFLRF-amide
  • Gene name:  FMRFa
  • Organism:  Sepia officinalis (Common cuttlefish)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Present ubiquitously in the brain and regions of the central nervous system as well as in the periphery and throughout the dermal chromatophore layer (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sepia (genus), Sepiidae (family), Sepiina (suborder), Sepiida (order), Decapodiformes (superorder), Coleoidea (subclass), Cephalopoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ALSGDAFLRF
  • Length:  10(74-83)
  • Propeptide:  MRCWSPCSLLVVIAIYCLSSHTSEAFDLAQACVESQRLSLLPICDTIFAVQQEGAQQSADDGLRSKRFIRFGRALSGDAFLRFGKNVPDLPFEDKRFLRFGRAAPQLDDLLKQALQRVESLQKSDDTSVRRKRSTDAAPQSNTDSAEQKNDSAKITKRYVDDVEDSDVKRFMRFGKRFMRFGRNPSDVGSKLTEKRFMRFGRDPEKRFMRFGKSDDKKFMRFGRNPGDAEDELEEDKRFMRFGRGDEEDEEEAEK
  • Signal peptide:  MRCWSPCSLLVVIAIYCLSSHTSEA
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excitatory neurotransmitters that directly modulate chromatophore function by activating chromatophore expansion at the chromatophore neuromuscular junction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P91889-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001801_AF2.pdbhor001801_ESM.pdb

Physical Information

Mass: 125697 Formula: C51H77N13O14
Absent amino acids: CEHIKMNPQTVWY Common amino acids: AFL
pI: 6.34 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 6
Hydrophobicity: 76 Boman Index: -668
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 98
Instability Index: 2826 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11060217
  • Title:  Mass spectrometric survey of peptides in cephalopods with an emphasis on the FMRFamide-related peptides.