HORDB

ID: hor001774
Uniprot ID: Q9ESQ9
Protein name: Neuropeptide NPSF
Gene name: Npvf
Organism: Rattus norvegicus (Rat)
Family: FARP (FMRFamide related peptide) family
Source: Animal
Expression: Isoform 1 is expressed at high levels in the hypothalamus and eye. Isoform 2 is specifically expressed in a region between the dorsomedial hypothalamic and ventromedial hypothalamic nuclei.
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0032277 negative regulation of gonadotropin secretion
GO CC: GO:0005576 extracellular region

Sequence: SVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRF
Length: 37(58-94)
Propeptide: MEIISSKRFILLTLATSSFLTSNTLCSDELMMPHFHSKEGYGKYYQLRGIPKGVKERSVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRFGRNIEDRRSPRARANMEAGTMSHFPSLPQRFGRTTARRITKTLAGLPQKSLHSLASSELLYAMTRQHQEIQSPGQEQPRKRVFTETDDAERKQEKIGNLQPVLQGAMKL
Signal peptide: MEIISSKRFILLTLATSSFLTSNTLC
Modification: T37 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Inhibit forskolin-induced production of cAMP;blocks morphine-induced analgesia
Mechanism: NA
Cross BBB: NA
Target: Npffr1
Target Unid: Q9EP86
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001774_AF2.pdb

hor001774_ESM.pdb

Mass:	473607	Formula:	C186H295N51O51S
Absent amino acids:	CY	Common amino acids:	AK
pI:	10.62	Basic residues:	7
Polar residues:	7	Hydrophobic residues:	14
Hydrophobicity:	-49.19	Boman Index:	-5478
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	71.35
Instability Index:	7418.92	Extinction Coefficient cystines:	5500
Absorbance 280nm:	152.78