General Information

  • ID:  hor001710
  • Uniprot ID:  Q9WVA8
  • Protein name:  Neuropeptide SF
  • Gene name:  Npff
  • Organism:  Mus musculus (Mouse)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0003254 regulation of membrane depolarization; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0010459 negative regulation of heart rate; GO:0030103 vasopressin secretion; GO:0032099 negative regulation of appetite; GO:0045777 positive regulation of blood pressure; GO:0046676 negative regulation of insulin secretion; GO:0060079 excitatory postsynaptic potential; GO:0070253 somatostatin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030425 dendrite; GO:0031982 vesicle; GO:0043204 perikaryon; GO:0043679 axon terminus; GO:0098794 postsynapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  SPAFLFQPQRF
  • Length:  11(72-82)
  • Propeptide:  MDSKWAALLLLLLLLLNWGHTEEAGSWGEDQVFAGEDKGPHPPQYAHIPDRIQTPGSLFRVLLQAMDTPRRSPAFLFQPQRFGRSAWGSWSKEQLNPQARQFWSLAAPQRFGKK
  • Signal peptide:  MDSKWAALLLLLLLLLNWGHT
  • Modification:  T11 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas.
  • Mechanism:  The suppression of E3 ubiquitin ligase RNF128 expression, resulting in enhanced stability of phosphorylated STAT6 and increased transcription of the M2 macrophage-associated genes IL-4 receptor ???(Il4ra), arginase 1 (Arg1), IL-10 (Il12), and alkylglycerol monooxygenase (Agmo)
  • Cross BBB:  NA
  • Target:  Npffr2, Npffr1
  • Target Unid:   Q924H0, E9Q468
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9WVA8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001710_AF2.pdbhor001710_ESM.pdb

Physical Information

Mass: 151608 Formula: C65H92N16O15
Absent amino acids: CDEGHIKMNTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: -13.64 Boman Index: -1373
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 44.55
Instability Index: 10156.36 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA