General Information

  • ID:  hor001685
  • Uniprot ID:  P19802
  • Protein name:  FMRF-amide 1
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in 280 cells of the CNS including the EGP heart excitatory motoneurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FMRF
  • Length:  4(152-155)
  • Propeptide:  MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCSMTKRFLRFGRALDTTDPFIRLRRQFYRIGRGGYQPYQDKRFLRFGRSEQPDVDDYLRDVVLQSEEPLYRKRRSTEAGGQSEEMTHRTARSAPEPAAENREIMKRETGAEDLDEEKRFMRFGRGDEEAEKRFMRFGKSFMRFGRDMSDVDKRFMRFGKRFMRFGREPGTDKRFMRFGREPGADKRFMRFGKSFDGEEENDDDLYYNESDADSNDDVDKRFM
  • Signal peptide:  MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCS
  • Modification:  T4 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces contractions in visceral and somatic musculature as well as in the heart. May play a role as cotransmitters or modulators in a number of significant neuronal systems
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P19802-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001685_AF2.pdbhor001685_ESM.pdb

Physical Information

Mass: 65343 Formula: C29H41N7O5S
Absent amino acids: ACDEGHIKLNPQSTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: 75 Boman Index: -661
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 0
Instability Index: -1135 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA