General Information

  • ID:  hor001676
  • Uniprot ID:  P42565
  • Protein name:  GDPFLRF-amide 1
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in 57 cells including a cardiorespiratory cell and the visceral white interneuron (VWI).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GDPFLRF
  • Length:  7(71-77)
  • Propeptide:  MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCSNSVDLDRKEFFPLGRHDGVYQTPEEDGDLEDRQTRGDPFLRFGRGDPFLRFGRGDPFLRFGRGDPFLRFGQSDPFLRFGRGDPFLRFGRGDPFLRFGKSDPFLRFGRSDPFLRFGRSDPFLRFGKSDPFLRFGKSDPFLRFGKSDPYLRFGRGDPFLRFGRSDPFFRFGKQQVATDDSGELDDEILSRVSDDDKNIRRKRSTDSAENAHTRHEREASAPR
  • Signal peptide:  MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCS
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  SDPFLRF-amide inhibits neurons.; SKPYMRF-amide excites neurons.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P42565-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001676_AF2.pdbhor001676_ESM.pdb

Physical Information

Mass: 95817 Formula: C41H58N10O10
Absent amino acids: ACEHIKMNQSTVWY Common amino acids: F
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -8.57 Boman Index: -1182
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 55.71
Instability Index: 6360 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2002360
  • Title:  Neuropeptides Gly-Asp-Pro-Phe-Leu-Arg-Phe-amide (GDPFLRFamide) and Ser-Asp-Pro-Phe-Leu-Arg-Phe-amide (SDPFLRFamide) are encoded by an exon 3' to Phe-Met-Arg-Phe-NH2 (FMRFamide) in the snail Lymnaea stagnalis.