General Information

  • ID:  hor001528
  • Uniprot ID:  Q8MPY9
  • Protein name:  EFNADDLTLRF-amide
  • Gene name:  flp-26
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Each flp gene is expressed in a distinct set of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EFNADDLTLRF
  • Length:  11(51-61)
  • Propeptide:  MKVMFMLALLFSSLVATSAFRLPFQFFGANEDFNSGLTKRNYYESKPYKREFNADDLTLRFGKRGGAGEPLAFSPDMLSLRFGK
  • Signal peptide:  MKVMFMLALLFSSLVATSA
  • Modification:  T11 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8MPY9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001528_AF2.pdbhor001528_ESM.pdb

Physical Information

Mass: 151901 Formula: C60H89N15O20
Absent amino acids: CGHIKMPQSVWY Common amino acids: DFL
pI: 3.88 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: -38.18 Boman Index: -3077
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 80
Instability Index: 1888.18 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry