General Information

  • ID:  hor001519
  • Uniprot ID:  Q7YX32
  • Protein name:  AQTFVRF-amide 1
  • Gene name:  flp-16
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Each flp gene is expressed in a distinct set of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045988 negative regulation of striated muscle contraction; GO:0071244 cellular response to carbon dioxide; GO:1903745 negative regulation of nematode pharyngeal pumping
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AQTFVRF
  • Length:  7(58-64)
  • Propeptide:  MNFSGFEFSSIVAFFLLILQLSTAAVLPADYAYGVADEMSALPDSGSLFAEQRPSKRAQTFVRFGKRAQTFVRFGKRGQTFVRFGRSAPFEQ
  • Signal peptide:  MNFSGFEFSSIVAFFLLILQLSTA
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the activity of dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7YX32-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001519_AF2.pdbhor001519_ESM.pdb

Physical Information

Mass: 97520 Formula: C41H61N11O10
Absent amino acids: CDEGHIKLMNPSWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: 41.43 Boman Index: -1122
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 55.71
Instability Index: 2620 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry