General Information

  • ID:  hor001510
  • Uniprot ID:  Q21156
  • Protein name:  Neuropeptide AF22
  • Gene name:  flp-11
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in adults . |Each flp gene is expressed in a distinct set of neurons .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0030431 sleep
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NGAPQPFVRF
  • Length:  10(76-85)
  • Propeptide:  MTQFSALALLLIVFVAASFAQSYDDVSAEKRAMRNALVRFGRASGGMRNALVRFGKRSPLDEEDFAPESPLQGKRNGAPQPFVRFGRSGQLDHMHDLLSTLQKLKFANNK
  • Signal peptide:  MTQFSALALLLIVFVAASFAQS
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q21156-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001510_AF2.pdbhor001510_ESM.pdb

Physical Information

Mass: 129299 Formula: C53H77N15O13
Absent amino acids: CDEHIKLMSTWY Common amino acids: FP
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -35 Boman Index: -1435
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 6252 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry.
  • PubMed ID:  16377032
  • Title:  FMRFamide Related Peptide Ligands Activate the Caenorhabditis Elegans Orphan GPCR Y59H11AL.1