General Information

  • ID:  hor001482
  • Uniprot ID:  Q1MX22
  • Protein name:  ARNHFIRL-amide
  • Gene name:  RFa
  • Organism:  Bombyx mori (Silk moth)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expression is continuous throughout the developmental period, but is highest during the feeding period in the early half of the fifth instar stage (days 0-4). Expression decreases remarkably on day 5 before larvae start wandering on day 6, but stabilizes
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ARNHFIRL
  • Length:  8(136-143)
  • Propeptide:  MNHPRSIAMLAALWLVVSVTSTPVRRSPDLEARRRSAIDRSMIRFGRSTLPVVPPAQPSFLQRYSAPQPAALTADDLMTFLRAYEEDYSSPVSKKSASFVRFGRDPSFIRFGRSVDEENSGYQAETNTYPQRRHRARNHFIRLGRDNELSESNDEDRYEVESERTKRSVVDPCNDCA
  • Signal peptide:  MNHPRSIAMLAALWLVVSVTS
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulates ecdysteroidogenesis
  • Mechanism:  Direct innervation of the prothoracic gland by reduce cAMP production via the receptor for myosuppressin.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q1MX22-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001482_AF2.pdbhor001482_ESM.pdb

Physical Information

Mass: 115125 Formula: C46H75N17O10
Absent amino acids: CDEGKMPQSTVWY Common amino acids: R
pI: 12.5 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -35 Boman Index: -2651
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 110
Instability Index: 1121.25 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16707581
  • Title:  Regulation of insect steroid hormone biosynthesis by innervating peptidergic neurons.