General Information

  • ID:  hor001383
  • Uniprot ID:  A0A423TEB2
  • Protein name:  FMRFamide-related peptide
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APERNFLRF
  • Length:  9(282-290)
  • Propeptide:  MFFAVWTLIAVITCSHYARSSPVPPVVGALEPSSQDFAQGQDDAFASPDKRLLKFGRGDEKRGDRNFLRFGRGDAAMDKRNRNFLRFGRGPNRNYIRFGRSDLAPLEFGLGLPEEELPVIIDHGDIDEMFEAFKQEKKNARNSIRHRRSVDRQLSSFCDNCDDSQKPQQTTTAQPAAHPAAAVAAVTRPKRSEAEAKDALSLQRSKRYVVPNYYGYSSYSMNHSPAAWAKMIPAEDLELEEEPQVLSKRAFNVLS
  • Signal peptide:  MFFAVWTLIAVITCSHYARS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A423TEB2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001383_AF2.pdbhor001383_ESM.pdb

Physical Information

Mass: 129218 Formula: C53H80N16O13
Absent amino acids: CDGHIKMQSTVWY Common amino acids: FR
pI: 10.4 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -71.11 Boman Index: -3060
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 54.44
Instability Index: 6801.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19852991
  • Title:  Combining in Silico Transcriptome Mining and Biological Mass Spectrometry for Neuropeptide Discovery in the Pacific White Shrimp Litopenaeus Vannamei