General Information

  • ID:  hor001249
  • Uniprot ID:  G5EFN6
  • Protein name:  FMRFamide-like peptide
  • Gene name:  flp-2
  • Organism:  Caenorhabditis elegans
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0030431 sleep; GO:0034514 mitochondrial unfolded protein response; GO:0040011 locomotion; GO:0050714 positive regulation of protein secretion
  • GO CC:  NA

Sequence Information

  • Sequence:  LRGEPIRF
  • Length:  8(75-82)
  • Propeptide:  MQVSGILSALFLVLLAVIVSPFQFVQPKRILPIPTSRDQLLRGQLAYLKGTTVAQPAVNDNTLGIFEASAMAKRLRGEPIRFGKRSPREPIRFGKRFNPLPDYDFQ
  • Signal peptide:  MQVSGILSALFLVLLAVIVSPFQFVQP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamide-like neuropeptides (PubMed:15809090, PubMed:24533288). Involved in mediating arousal from the sleep-like state called lethargus, which occurs during molting between larval and adult stages, in part by regulating touch sensitivity, and working in
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G5EFN6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001249_AF2.pdbhor001249_ESM.pdb

Physical Information

Mass: 111220 Formula: C45H74N14O11
Absent amino acids: ACDHKMNQSTVWY Common amino acids: R
pI: 10.4 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -42.5 Boman Index: -2289
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 97.5
Instability Index: 3686.25 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20806053
  • Title:  Mapping Neuropeptide Expression by Mass Spectrometry in Single Dissected Identified Neurons From the Dorsal Ganglion of the Nematode Ascaris Suum