General Information

  • ID:  hor001248
  • Uniprot ID:  G5EGN5
  • Protein name:  FLP-8
  • Gene name:  flp-8
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0061096 negative regulation of turning behavior involved in mating
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KNEFIRF
  • Length:  7(74-80)
  • Propeptide:  MLSGVLFSIFVLAISANASCDVSALTTENEKELGLRICHLEAEMQVVQRALQEVMQQTDVTLYDQEVPVMNKRKNEFIRFGKRSDGMEKRKNEFIRFGKRKNEFIRFGRSDKGLGLDDNDVSSEFFGYTSDVFYL
  • Signal peptide:  MLSGVLFSIFVLAISANA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G5EGN5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001248_AF2.pdbhor001248_ESM.pdb

Physical Information

Mass: 106030 Formula: C45H68N12O11
Absent amino acids: ACDGHLMPQSTVWY Common amino acids: F
pI: 9.69 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -75.71 Boman Index: -2304
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 55.71
Instability Index: 857.14 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans