General Information

  • ID:  hor001239
  • Uniprot ID:  O61466
  • Protein name:  FLP-5
  • Gene name:  flp-5
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in adults. |Each flp gene is expressed in a distinct set of neurons. Flp-5 is expressed in the ASE sensory neurons, the 14 and M4 cholinergic pharyngeal motoneurons, and the PV
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGAKFIRFG
  • Length:  9(54-62)
  • Propeptide:  MSSRSTTIAFLFIATLLVFQCVSAQSSAEDADYLEKYQRIARAPKPKFIRFGRAGAKFIRFGRSRNTWEDGYASPSVNELYVKRGAKFIRFG
  • Signal peptide:  NA
  • Modification:  T8 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides. GAKFIRF-amide has an excitatory effect on dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O61466-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001239_AF2.pdbhor001239_ESM.pdb

Physical Information

Mass: 110903 Formula: C46H71N13O10
Absent amino acids: CDEHLMNPQSTVWY Common amino acids: AFG
pI: 11.65 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: 50 Boman Index: -409
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.56
Instability Index: -54.44 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.