General Information

  • ID:  hor001237
  • Uniprot ID:  Q86G91
  • Protein name:  FLP-33
  • Gene name:  flp-33
  • Organism:  Caenorhabditis elegans
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  APLEGFEDMSGFLRTIDGIQKPRF
  • Length:  24(62-85)
  • Propeptide:  MRFLILIVAIVLLSAVHGFSVEPRLAAFADGGAAELAQEARQARNAELEFIKRFLPAKERRAPLEGFEDMSGFLRTIDGIQKPRFG
  • Signal peptide:  MRFLILIVAIVLLSAVHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q86G91-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001237_AF2.pdbhor001237_ESM.pdb

Physical Information

Mass: 313554 Formula: C123H190N32O36S
Absent amino acids: CHNVWY Common amino acids: FG
pI: 4.54 Basic residues: 3
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: -31.67 Boman Index: -4236
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 69.17
Instability Index: 4214.58 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans