General Information

  • ID:  hor001227
  • Uniprot ID:  Q6LAC9
  • Protein name:  FLP-25
  • Gene name:  flp-25
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DYDFVRFG
  • Length:  8(71-78)
  • Propeptide:  MSHNSMIYLLVAFLVLLCATTEAKKECSIDCQEDGSAAVDLGLVLPPELYESTRLSNLLARPSSQFKMKRDYDFVRFGRAAPIKKASYDYIRFGRK
  • Signal peptide:  MSHNSMIYLLVAFLVLLCATTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6LAC9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001227_AF2.pdbhor001227_ESM.pdb

Physical Information

Mass: 114313 Formula: C48H63N11O14
Absent amino acids: ACEHIKLMNPQSTW Common amino acids: DF
pI: 4.11 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -42.5 Boman Index: -2156
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 36.25
Instability Index: 2892.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.