General Information

  • ID:  hor001217
  • Uniprot ID:  Q9XVX1
  • Protein name:  FLP-19
  • Gene name:  flp-19
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in adults. |Each flp gene is expressed in a distinct set of neurons. Flp-19 is expressed in the URX interneurons, the serotonin and acetylcholine-expressing HSN neurons, and th
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WANQVRFG
  • Length:  8(70-77)
  • Propeptide:  MSFQLTLFSMLFLLIAVVVGQPIQSQNGDLKMQAVQDNSPLNMEAFNDDSALYDYLEQSDPSLKSMEKRWANQVRFGKRASWASSVRFG
  • Signal peptide:  MSFQLTLFSMLFLLIAVVVG
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides. WANQVRF-amide inhibits the activity of dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XVX1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001217_AF2.pdbhor001217_ESM.pdb

Physical Information

Mass: 110213 Formula: C45H64N14O11
Absent amino acids: CDEHIKLMPSTY Common amino acids: AFGNQRVW
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -50 Boman Index: -1500
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 48.75
Instability Index: -2888.75 Extinction Coefficient cystines: 5500
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.