General Information

  • ID:  hor001216
  • Uniprot ID:  Q9XVX1
  • Protein name:  FLP-19
  • Gene name:  flp-19
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed from the comma stage of embryogenesis, during all larval stages, and in adults. |Each flp gene is expressed in a distinct set of neurons. Flp-19 is expressed in the URX interneurons, the serotonin and acetylcholine-expressing HSN neurons, and th
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ASWASSVRF
  • Length:  9(80-88)
  • Propeptide:  MSFQLTLFSMLFLLIAVVVGQPIQSQNGDLKMQAVQDNSPLNMEAFNDDSALYDYLEQSDPSLKSMEKRWANQVRFGKRASWASSVRFG
  • Signal peptide:  MSFQLTLFSMLFLLIAVVVG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides. WANQVRF-amide inhibits the activity of dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XVX1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001216_AF2.pdbhor001216_ESM.pdb

Physical Information

Mass: 115298 Formula: C46H67N13O13
Absent amino acids: CDEGHIKLMNPQTY Common amino acids: S
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: 31.11 Boman Index: -1215
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 1358.89 Extinction Coefficient cystines: 5500
Absorbance 280nm: 687.5

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans