General Information

  • ID:  hor001149
  • Uniprot ID:  H2D5R9
  • Protein name:  Neuropeptide AF27
  • Gene name:  afp-11
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PADPNFLRF
  • Length:  9(132-140)
  • Propeptide:  MSPLHVALFLIFCSSQVLGECCNDGQTSDFCAVFNMLSPTEQAEVRSYLGDNCDGDADEAVRKIEKRKPNFIRFGRTAPPLTFGKKGSDPNFLRFGRTPSNNFLRFGKSNQAQNFLRFGRNAEPNFLRFGRPADPNFLRFGKSAEPNFLRFGKRSDIGISEPNFLRFGRNNFLRFGRNDQFDREYRKPNFLRFGK
  • Signal peptide:  MSPLHVALFLIFCSSQVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-H2D5R9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001149_AF2.pdbhor001149_ESM.pdb

Physical Information

Mass: 121909 Formula: C51H73N13O13
Absent amino acids: CEGHIKMQSTVWY Common amino acids: FP
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -38.89 Boman Index: -1759
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 54.44
Instability Index: 2555.56 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21524146
  • Title:  Discovery of Neuropeptides in the Nematode Ascaris Suum by Database Mining and Tandem Mass Spectrometry