General Information

  • ID:  hor001122
  • Uniprot ID:  A0A3Q0KCT3
  • Protein name:  FMRFamide-like peptide
  • Gene name:  NA
  • Organism:  Schistosoma mansoni (Blood fluke)
  • Family:  Peptidase U48 family
  • Source:  Animal
  • Expression:  nervous system
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Schistosoma (genus), Schistosomatidae (family), Schistosomatoidea (superfamily), Strigeidida (order), Digenea (subclass), Trematoda (class), Platyhelminthes (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004175 endopeptidase activity; GO:0004222 metalloendopeptidase activity; GO:0008233 peptidase activity; GO:0016787 hydrolase activity
  • GO BP:  GO:0006508 proteolysis; GO:0016485 protein processing; GO:0071586 CAAX-box protein processing; GO:0080120 CAAX-box protein maturation
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005789 endoplasmic reticulum membrane; GO:0016020 membrane

Sequence Information

  • Sequence:  YIRF
  • Length:  4(54-57)
  • Propeptide:  MYEILNCIVYSFLFISGLYFAGGKFPRDHPETIKRRVVSVFVTGAISMTHVLTYIRFYDHPPFQLSSYEFGKLFIRLDGLLEAVIISVILTLVMYFGVVLDDIFSGDMLVILDVQYWKDRIFNWISLRNFVIAPLAEELIFRACVTFHLLPLFSSCVMLCFVSSLFFSLAHFHHVFESVKSGQDLQSAFKTSLFQVFYTTLFGMYSGFLMLRTGNIASSIVTHSLCNFFGLPDLIGAIERAKYRWGISGQIFAIG
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  produce potent myoexcitation
  • Mechanism:  elicit contractions by enhancing Ca(2+) influx through VOCC currents using a PKC-dependent pathway
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A3Q0KCT3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001122_AF2.pdbhor001122_ESM.pdb

Physical Information

Mass: 65140 Formula: C30H43N7O6
Absent amino acids: ACDEGHKLMNPQSTVW Common amino acids: FIRY
pI: 9.35 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: 37.5 Boman Index: -716
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 97.5
Instability Index: 750 Extinction Coefficient cystines: 1490
Absorbance 280nm: 496.67

Literature

  • PubMed ID:  20706630
  • Title:  FMRFamide-like Peptides (FLPs) Enhance Voltage-Gated Calcium Currents to Elicit Muscle Contraction in the Human Parasite Schistosoma Mansoni