General Information

  • ID:  hor001119
  • Uniprot ID:  Q08819
  • Protein name:  Antho-RFamide
  • Gene name:  NA
  • Organism:  Renilla koellikeri (Koelliker's sea pansy)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Renilla (genus), Renillidae (family), Sessiliflorae (suborder), Pennatulacea (order), Octocorallia (subclass), Anthozoa (class), Cnidaria (phylum), Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0016020 membrane

Sequence Information

  • Sequence:  QGRFG
  • Length:  5(103-107)
  • Propeptide:  MVSLGFFVRDVTPTFIVDHMFYMLFPMDFTCYVAGLLLILNTYSLAGPSTSEGLNERNLLDKTELSINDEIFSEDDDMLARDAEDKQGRFNRKLNNKLNEAVQGRFGRNERKESEEEQGRFGRENEKQGRFGRESEEQGRFGRENKEQGRFGRENKEQGRFGRENEEQGRFGRESEEQGRFGRENEEQGRFGRENEEQGRFGRENEEQGRFGRENEEQGRFGRENEVQGRFGRENEEQGRFGRENEEQGRFGREN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Mediate or modulate neuronal communication
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001119_AF2.pdbhor001119_ESM.pdb

Physical Information

Mass: 63514 Formula: C24H37N9O7
Absent amino acids: ACDEHIKLMNPSTVWY Common amino acids: G
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 1
Hydrophobicity: -120 Boman Index: -1560
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 800 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7906718
  • Title:  Primary structure of the precursor for the anthozoan neuropeptide antho-RFamide from Renilla koellikeri: evidence for unusual processing enzymes.