General Information

  • ID:  hor001116
  • Uniprot ID:  Q9WVA9
  • Protein name:  Neuropeptide AF
  • Gene name:  Npff
  • Organism:  Rattus norvegicus (Rat)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0002438 acute inflammatory response to antigenic stimulus; GO:0003254 regulation of membrane depolarization; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0009410 response to xenobiotic stimulus; GO:0010459 negative regulation of heart rate; GO:0021510 spinal cord development; GO:0030103 vasopressin secretion; GO:0032099 negative regulation of appetite; GO:0045777 positive regulation of blood pressure; GO:0046676 negative regulation of insulin secretion; GO:0060079 excitatory postsynaptic potential; GO:0060135 maternal process involved in female pregnancy; GO:0070253 somatostatin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030425 dendrite; GO:0031982 vesicle; GO:0043204 perikaryon; GO:0043679 axon terminus; GO:0098794 postsynapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  NAWGPWSKEQLSPQA
  • Length:  15
  • Propeptide:  MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMRVLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK
  • Signal peptide:  MDSKWAAVLLLLLLLRNWGHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The tail-immersion and the expression of morphine-induced CPP assays
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npffr2, Npffr1
  • Target Unid:  Q9EQD2, Q9EP86
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9WVA9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001116_AF2.pdbhor001116_ESM.pdb

Physical Information

Mass: 194875 Formula: C77H111N21O23
Absent amino acids: CDFHIMRTVY Common amino acids: APQSW
pI: 6.41 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 5
Hydrophobicity: -116.67 Boman Index: -2274
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 39.33
Instability Index: 5547.33 Extinction Coefficient cystines: 11000
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  17980934
  • Title:  A novel cryptic peptide derived from the rat neuropeptide FF precursor reverses antinociception and conditioned place preference induced by morphine