General Information

  • ID:  hor001104
  • Uniprot ID:  Q9WVA8
  • Protein name:  Neuropeptide SF
  • Gene name:  Npff
  • Organism:  Mus musculus (Mouse)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0003254 regulation of membrane depolarization; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0010459 negative regulation of heart rate; GO:0030103 vasopressin secretion; GO:0032099 negative regulation of appetite; GO:0045777 positive regulation of blood pressure; GO:0046676 negative regulation of insulin secretion; GO:0060079 excitatory postsynaptic potential; GO:0070253 somatostatin secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030425 dendrite; GO:0031982 vesicle; GO:0043204 perikaryon; GO:0043679 axon terminus; GO:0098794 postsynapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  SLAAPQRF
  • Length:  8
  • Propeptide:  MDSKWAALLLLLLLLLNWGHTEEAGSWGEDQVFAGEDKGPHPPQYAHIPDRIQTPGSLFRVLLQAMDTPRRSPAFLFQPQRFGRSAWGSWSKEQLNPQARQFWSLAAPQRFGKK
  • Signal peptide:  MDSKWAALLLLLLLLLNWGHT
  • Modification:  T8 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npffr2, Npffr1
  • Target Unid:  Q924H0, E9Q468
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9WVA8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001104_AF2.pdbhor001104_ESM.pdb

Physical Information

Mass: 101406 Formula: C40H64N12O11
Absent amino acids: CDEGHIKMNTVWY Common amino acids: A
pI: 10.55 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 4
Hydrophobicity: -2.5 Boman Index: -1234
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.75
Instability Index: 5690 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  22580381
  • Title:  Crypteins Derived From the Mouse Neuropeptide FF (NPFF)A Precursor Display NPFF-like Effects in Nociceptive Tests in Mice