General Information

  • ID:  hor001100
  • Uniprot ID:  A0A914KQ46
  • Protein name:  APLDRSALVRFamide
  • Gene name:  Mi-flp-7
  • Organism:  Meloidogyne incognita (Southern root-knot nematode)
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Meloidogyne incognita group, Meloidogyne (genus), Meloidogyninae (subfamily), Meloidogynidae (family), Tylenchoidea (superfamily), Tylenchomorpha (infraorder), Tylenchina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APLDRSALVRF
  • Length:  11(69-79)
  • Propeptide:  MAQIIFNTLLATLIFSAFFISRFSNGQLTNDFGSQLMSLQDFGDDYNNAIFADIDGDNENSYESMAKRAPLDRSALVRFGKRAPLDRSALVRFGKRAPLDRAAMVRFGKRAPLDRAAMVRFGKRAPFDRSSMVRFGKRK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exert potent physiological effects on locomotory, feeding and reproductive musculature and also act as neuromodulators.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001100_AF2.pdbhor001100_ESM.pdb

Physical Information

Mass: 142301 Formula: C56H93N17O15
Absent amino acids: CEGHIKMNQTWY Common amino acids: ALR
pI: 10.4 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 6
Hydrophobicity: 30 Boman Index: -2148
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 115.45
Instability Index: 5969.09 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19843350
  • Title:  FMRFamide-like peptides in root knot nematodes and their potential role in nematode physiology.