General Information

  • ID:  hor001062
  • Uniprot ID:  Q9BH15
  • Protein name:  Neuropeptide AF2
  • Gene name:  flp-3
  • Organism:  Globodera pallida (Potato cyst nematode)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  anterior ganglion and a number of paired cells posterior to the circumpharyngeal
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Globodera (genus), Heteroderinae (subfamily), Heteroderidae (family), Tylenchoidea (superfamily), Tylenchomorpha (infraorder), Tylenchina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KHEYLRF
  • Length:  7
  • Propeptide:  MTIRSSSSSCSSPLSSLLHRGFVVLCALSVLQFKPSLTTAAAVFAESGPSSSSVDQFVHSDCAQLAGGDEERLLLCQLYESSALLAQLGVLVNEGIGRLAVSQGMGNKFIVADGGREKRKHEYLRFGKRKHEYLRFGRK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of both dorsal and ventral body wall muscles, the musculature of the vulva and in the function of a number of sensory structures in both the head and tail
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9BH15-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001062_AF2.pdbhor001062_ESM.pdb

Physical Information

Mass: 109934 Formula: C47H69N13O11
Absent amino acids: ACDGIMNPQSTVW Common amino acids: EFHKLRY
pI: 9.3 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -140 Boman Index: -2418
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 55.71
Instability Index: 3608.57 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  12117492
  • Title:  Localisation of Globodera Pallida FMRFamide-related Peptide Encoding Genes Using in Situ Hybridisation