General Information

  • ID:  hor001035
  • Uniprot ID:  A0A8J9VRV9
  • Protein name:  FMRFamide
  • Gene name:  TIGD4
  • Organism:  Branchiostoma lanceolatum (Common lancelet) (Amphioxus lanceolatum)
  • Family:  Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
  • Source:  Animal
  • Expression:   In the larvae, FMRFamide-containing presumably neuronal perikarya and fibers were limited to the anterior third of the dorsal nerve cord; In adult lancelets, be detected in cells of the Hatschek's pit
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Branchiostoma (genus), Branchiostomatidae (family), Amphioxiformes (order), Leptocardii (class), Cephalochordata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003676 nucleic acid binding; GO:0003677 DNA binding
  • GO BP:  GO:0006850 mitochondrial pyruvate transmembrane transport
  • GO CC:  GO:0005634 nucleus; GO:0005739 mitochondrion; GO:0005743 mitochondrial inner membrane; GO:0016020 membrane

Sequence Information

  • Sequence:  FMRF
  • Length:  4(461-464)
  • Propeptide:  MPINTPERKRVDLTLADKVKVIQLLDSVPKLSQTEVGKRFGCSTSQVCRVNKNRETIMRLWECNSNPNRKRKREGKSGEVEEALMRWFVNARAKGAQISGPILMEKAKQFAVGLGEVDFKPTEGWLGRWKQRNNIVFKRAHGEKKDADSQSAEDWVRDVLPTILQEYDPEDVYNCDETGLLYRALPSGTLALKTENVSGGKKAMDRISVMFCCNMTGTDKLTPLIIGHSKNPRCFRGQRVPLPWESNKKAWMTAA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in neuroendocrine functions of lancelets
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001035_AF2.pdbhor001035_ESM.pdb

Physical Information

Mass: 65343 Formula: C29H41N7O5S
Absent amino acids: ACDEGHIKLNPQSTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 2
Hydrophobicity: 75 Boman Index: -661
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 0
Instability Index: -1135 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10340145
  • Title:  Distribution and localization of immunoreactive FMRFamide-like peptides in the lancelet