General Information

  • ID:  hor001034
  • Uniprot ID:  F1LHM7
  • Protein name:  Neuropeptide PF4
  • Gene name:  NA
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  FMRFamide related peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KPNFIRF
  • Length:  7(76-82)
  • Propeptide:  MMRQSHSVMSPYYVALFLIFCSSQVLGECCNDGQTSDFCAVFNMLSPTEQAEVRSYLGDNCDGDADEAVRKIEKRKPNFIRFGRTAPPLTFGKKGSDPNFLRFG
  • Signal peptide:  MMRQSHSVMSPYYVALFLIFCSSQVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Elicit a potent, inhibition of Ascaris muscle cells which is partially mediated by chloride
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  muscle cells:98 nM
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F1LHM7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001034_AF2.pdbhor001034_ESM.pdb

Physical Information

Mass: 102830 Formula: C45H68N12O9
Absent amino acids: ACDEGHLMQSTVWY Common amino acids: F
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -48.57 Boman Index: -1623
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 55.71
Instability Index: -2367.14 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9031739
  • Title:  The peptidergic nervous system of the triclad turbellarian, Bdelloura candida (Maricola, Bdellouridae): an immunocytochemical study using an antiserum raised to an endogenous neuropeptide, GYIRFamide.