HORDB

ID: hor001022
Uniprot ID: A0A8K9UK46
Protein name: CCK-8
Gene name: cck-n
Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Family: Gastrin/cholecystokinin family
Source: Animal
Expression: Brain
Disease: NA
Comments: NA
Taxonomy: Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007165 signal transduction; GO:0007586 digestion
GO CC: GO:0005576 extracellular region

Sequence: DYNGWMDF
Length: 8(119-126)
Propeptide: MTAGLCVCVLLVVLSTSCLGRPQSSPPLQEGDPAMPPSSEARLEAYAHFLSKPRLRQTRSAPLDNTVPYTAEEDGDSRANLSELLARLISSRKGSLRKNSTVNSRASGLSANHRIKDRDYNGWMDFGRRSAEEYEYSL
Signal peptide: MTAGLCVCVLLVVLSTSCLG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001022_AF2.pdb

hor001022_ESM.pdb

Mass:	117215	Formula:	C48H58N10O15S
Absent amino acids:	ACEHIKLPQRSTV	Common amino acids:	D
pI:	3.49	Basic residues:	0
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-105	Boman Index:	-1562
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	2556.25	Extinction Coefficient cystines:	6990
Absorbance 280nm:	998.57

PubMed ID: 11342099
Title: Identification and Distribution of CCK-related Peptides and mRNAs in the Rainbow Trout, Oncorhynchus Mykiss