HORDB

ID: hor001012
Uniprot ID: P48757
Protein name: Gastrin
Gene name: GAST
Organism: Mus musculus (Mouse)
Family: Gastrin/cholecystokinin family
Source: Animal
Expression: Abundantly expressed in the stomach and duodenum. Low levels in brain, ovary and pancreas.
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QRPRMEEEEEAYGWMDF
Length: 17(76-92)
Propeptide: MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEDQ
Signal peptide: MPRLCVYMLVLVLALATFSEA
Modification: T12 Sulfotyrosine;T17 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Mechanism: NA
Cross BBB: NA
Target: Cckbr
Target Unid: P56481
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001012_AF2.pdb

hor001012_ESM.pdb

Mass:	248894	Formula:	C95H135N25O32S2
Absent amino acids:	CHIKLNSTV	Common amino acids:	E
pI:	3.87	Basic residues:	2
Polar residues:	2	Hydrophobic residues:	3
Hydrophobicity:	-172.35	Boman Index:	-6553
Half-Life / Aliphatic Index:	0.8 hour	Aliphatic Index:	5.88
Instability Index:	10477.06	Extinction Coefficient cystines:	6990
Absorbance 280nm:	436.88