General Information

  • ID:  hor000962
  • Uniprot ID:  P80344
  • Protein name:  Cholecystokinin-8
  • Gene name:  CCK
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DYMGWMDF
  • Length:  8(111-118)
  • Propeptide:  MYIGICICVLLAALSASSTGQQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYIGICICVLLAALSASSTG
  • Modification:  T2 Sulfotyrosine;T8 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.
  • Mechanism:  Frog brain contains CCK-octapeptide (CCK8) and CCK7; whereas the gut contains intact CCK33 and CCK58.
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  18 minute; /1080 seconds ( PubMed ID: 6291099 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80344-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000962_AF2.pdbhor000962_ESM.pdb

Physical Information

Mass: 118924 Formula: C49H61N9O14S2
Absent amino acids: ACEHIKLNPQRSTV Common amino acids: DM
pI: 3.49 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -37.5 Boman Index: -663
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 0
Instability Index: 9927.5 Extinction Coefficient cystines: 6990
Absorbance 280nm: 998.57

Literature

  • PubMed ID:  7925386##6291099
  • Title:  Identification of Cholecystokinin From Frog and Turtle. Divergence of Cholecystokinin and Gastrin Occurred Before the Evolution of Amphibia