General Information

  • ID:  hor000952
  • Uniprot ID:  P01353
  • Protein name:  Cholecystokinin-5
  • Gene name:  GAST
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GWMDF
  • Length:  5(88-92)
  • Propeptide:  MQRLCVYVLILALALATFSEASWKPRSRLQDAPSGPGANRGLEPHGLDQLGPASHHRRQLGLQGPPQLVADLSKKQGPWMEEEEAAYGWMDFGRRSAEEGDQRP
  • Signal peptide:  MQRLCVYVLILALALATFSEA
  • Modification:  T5 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01353-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000952_AF2.pdbhor000952_ESM.pdb

Physical Information

Mass: 72627 Formula: C31H38N6O8S
Absent amino acids: ACEHIKLNPQRSTVY Common amino acids: DFGMW
pI: 3.75 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -2 Boman Index: -12
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 0
Instability Index: 6496 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1375

Literature

  • PubMed ID:  2430967
  • Title:  New Molecular Forms of Cholecystokinin. Microsequence Analysis of Forms Previously Characterized by Chromatographic Methods