General Information

  • ID:  hor000935
  • Uniprot ID:  P16240
  • Protein name:  Cionin
  • Gene name:  NA
  • Organism:  Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed in both the gut and the neural ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NYYGWMDF
  • Length:  8(109-116)
  • Propeptide:  MGSNIVIYFSIIVIVTLNVNGVPASDLFKSVSQYHIPRSKVINKETVTKPLQFQRAICRLLQKLGEETFARLSQSELEAKQLDLIKTCYQANSFGDNENQGHMQRMDRNYYGWMDFGKRAIEDVDYEY
  • Signal peptide:  MGSNIVIYFSIIVIVTLNVNGV
  • Modification:  T2 Sulfotyrosine;T3 Sulfotyrosine;T8 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P16240-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000935_AF2.pdbhor000935_ESM.pdb

Physical Information

Mass: 122023 Formula: C53H62N10O14S
Absent amino acids: ACEHIKLPQRSTV Common amino acids: Y
pI: 3.75 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -77.5 Boman Index: -704
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 4916.25 Extinction Coefficient cystines: 8480
Absorbance 280nm: 1211.43

Literature

  • PubMed ID:  2303439
  • Title:  Cionin: a disulfotyrosyl hybrid of cholecystokinin and gastrin from the neural ganglion of the protochordate Ciona intestinalis.