HORDB

ID: hor000935
Uniprot ID: P16240
Protein name: Cionin
Gene name: NA
Organism: Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: Expressed in both the gut and the neural ganglion.
Disease: NA
Comments: NA
Taxonomy: Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: NYYGWMDF
Length: 8
Propeptide: MGSNIVIYFSIIVIVTLNVNGVPASDLFKSVSQYHIPRSKVINKETVTKPLQFQRAICRLLQKLGEETFARLSQSELEAKQLDLIKTCYQANSFGDNENQGHMQRMDRNYYGWMDFGKRAIEDVDYEY
Signal peptide: MGSNIVIYFSIIVIVTLNVNGV
Modification: T2 Sulfotyrosine;T3 Sulfotyrosine;T8 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000935_AF2.pdb

hor000935_ESM.pdb

Mass:	122023	Formula:	C53H62N10O14S
Absent amino acids:	ACEHIKLPQRSTV	Common amino acids:	Y
pI:	3.75	Basic residues:	0
Polar residues:	4	Hydrophobic residues:	2
Hydrophobicity:	-77.5	Boman Index:	-704
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	4916.25	Extinction Coefficient cystines:	8480
Absorbance 280nm:	1211.43

PubMed ID: 2303439
Title: Cionin: a disulfotyrosyl hybrid of cholecystokinin and gastrin from the neural ganglion of the protochordate Ciona intestinalis.