General Information

  • ID:  hor000923
  • Uniprot ID:  A0A7M7GIX9
  • Protein name:  Sulfakinin
  • Gene name:  LOC102654729
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QQFDDYGHLRF
  • Length:  11(77-87)
  • Propeptide:  MDRAFFRRFPILHHTDMNLTFVLTCVMAIIWLFFAKCETEIVSNLRQRFRNRPLLREYNVENLLLEEDDFTNLNKRQQFDDYGHLRFGKREQFEDYGHMRFGRNHHK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GIX9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000923_AF2.pdbhor000923_ESM.pdb

Physical Information

Mass: 160408 Formula: C65H88N18O19
Absent amino acids: ACEIKMNPSTVW Common amino acids: DFQ
pI: 5.41 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -127.27 Boman Index: -3642
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 35.45
Instability Index: 4075.45 Extinction Coefficient cystines: 1490
Absorbance 280nm: 149

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera