General Information

  • ID:  hor000921
  • Uniprot ID:  A0A6I8TD07
  • Protein name:  Sulfakinin-1
  • Gene name:  110677123
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FDDYGHMRF
  • Length:  9
  • Propeptide:  MARLTLSILISLTIYFTYQAVASEALSTSGVRSSSNSQSTRSSEAMESLLGRDDGLNKLQSVWFKNVYSRRSAGPVGPGHIGTYTVLQRSPAGGSKLPLAYVADINFIDDEDIEKRFDDYGHMRFGKRGGGGEGEQFDDYGHMRFGRR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6I8TD07-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000921_AF2.pdbhor000921_ESM.pdb

Physical Information

Mass: 133017 Formula: C54H70N14O15S
Absent amino acids: ACEIKLNPQSTVW Common amino acids: DF
pI: 5.41 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -98.89 Boman Index: -2791
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 478.89 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti