General Information

  • ID:  hor000920
  • Uniprot ID:  Q4ADV6
  • Protein name:  Cholecystokinin 8
  • Gene name:  CCK
  • Organism:  Seriola quinqueradiata (Five-ray yellowtail)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  brain , pyloric caeca and anterior intestine
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Seriola (genus), Carangidae (family), Carangiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DYLGWMDF
  • Length:  8
  • Propeptide:  VCVVLAVLCTSCLGLPFSSQPLDEGQRSVSAPSEALLDADIHTLGEPQLRHSRSASQLKALPLAEDDADSRANLSELLARLISSRKGSVRRNSTANSRGSGLSANHRIADRDYLGWMDFGRRSAEEYEYSS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates pancreatic exocrine secretion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q4ADV6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000920_AF2.pdbhor000920_ESM.pdb

Physical Information

Mass: 117121 Formula: C50H63N9O14S
Absent amino acids: ACEHIKNPQRSTV Common amino acids: D
pI: 3.49 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -13.75 Boman Index: -406
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 4435 Extinction Coefficient cystines: 6990
Absorbance 280nm: 998.57

Literature

  • PubMed ID:  16242687
  • Title:  Cholecystokinin and Peptide Y in Yellowtail (Seriola Quinqueradiata): Molecular Cloning, Real-Time Quantitative RT-PCR, and Response to Feeding and Fasting