General Information

  • ID:  hor000916
  • Uniprot ID:  NA
  • Protein name:  Cholecystokinin-69
  • Gene name:  NA
  • Organism:  Pseudis bolbodactyla
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  brain and small intestine
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  ASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
  • Length:  69
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000916_AF2.pdbhor000916_ESM.pdb

Physical Information

Mass: 891385 Formula: C337H536N100O101S3
Absent amino acids: CE Common amino acids: ADRS
pI: 10.35 Basic residues: 11
Polar residues: 20 Hydrophobic residues: 21
Hydrophobicity: -56.38 Boman Index: -15105
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.97
Instability Index: 3984.64 Extinction Coefficient cystines: 9970
Absorbance 280nm: 146.62

Literature

  • PubMed ID:  7925386
  • Title:  Identification of Cholecystokinin From Frog and Turtle. Divergence of Cholecystokinin and Gastrin Occurred Before the Evolution of Amphibia