General Information

  • ID:  hor000911
  • Uniprot ID:  P80345
  • Protein name:  Cholecystokinin-70
  • Gene name:  NA
  • Organism:  Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed in brain, duodenum and small intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Trachemys (genus), Emydidae (family), Testudinoidea (superfamily), Durocryptodira, Cryptodira (suborder), Testudines (order), Testudinata (subclass), Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMD
  • Length:  69(49-117)
  • Propeptide:  MYSGICIYMFLAMLSTSSSGQQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYSGICIYMFLAMLSTSSSG
  • Modification:  T64 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear.
  • Mechanism:  Turtle brain contains CCK-octapeptide (CCK8) and CCK7, whereas the gut contains intact CCK33, CCK40 and CCK58.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80345-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000911_AF2.pdbhor000911_ESM.pdb

Physical Information

Mass: 892094 Formula: C330H541N105O100S4
Absent amino acids: CEF Common amino acids: GDQR
pI: 10.56 Basic residues: 11
Polar residues: 19 Hydrophobic residues: 19
Hydrophobicity: -74.06 Boman Index: -16208
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 76.38
Instability Index: 3790.58 Extinction Coefficient cystines: 8480
Absorbance 280nm: 124.71

Literature

  • PubMed ID:  7925386
  • Title:  Identification of Cholecystokinin From Frog and Turtle. Divergence of Cholecystokinin and Gastrin Occurred Before the Evolution of Amphibia