General Information

  • ID:  hor000910
  • Uniprot ID:  NA
  • Protein name:  Cholecystokinin-58
  • Gene name:  NA
  • Organism:  NA
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDF
  • Length:  58
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T52 Sulfotyrosine;T58 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induce contraction of the guinea-pig gallbladder
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000910_AF2.pdbhor000910_ESM.pdb

Physical Information

Mass: 758941 Formula: C285H459N89O84S3
Absent amino acids: CT Common amino acids: ARSDL
pI: 10.31 Basic residues: 11
Polar residues: 13 Hydrophobic residues: 19
Hydrophobicity: -55.69 Boman Index: -13692
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 79.14
Instability Index: 4308.79 Extinction Coefficient cystines: 8480
Absorbance 280nm: 148.77

Literature

  • PubMed ID:  6468664
  • Title:  Isolation and Characterization of cholecystokinin-58 (CCK-58) From Porcine Brain