General Information

  • ID:  hor000906
  • Uniprot ID:  NA
  • Protein name:  Cholecystokinin-58
  • Gene name:  NA
  • Organism:  Mus musculus
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
  • Length:  58
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T52 Sulfotyrosine;T58 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000906_AF2.pdbhor000906_ESM.pdb

Physical Information

Mass: 759945 Formula: C287H461N89O83S3
Absent amino acids: CT Common amino acids: ARDLS
pI: 10.31 Basic residues: 11
Polar residues: 12 Hydrophobic residues: 19
Hydrophobicity: -57.07 Boman Index: -13352
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 79.14
Instability Index: 4604.31 Extinction Coefficient cystines: 8480
Absorbance 280nm: 148.77

Literature

  • PubMed ID:  16904071
  • Title:  Crucial Role of Position 40 for Interactions of CCK-58 Revealed by Sequence of Cat CCK-58