General Information

  • ID:  hor000904
  • Uniprot ID:  P09859
  • Protein name:  Gastrin
  • Gene name:  NA
  • Organism:  Gallus gallus (Chicken)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDF
  • Length:  36
  • Propeptide:  MKTKVFLGLILSAAVTACLCRPAAKAPGGSHRPTSSLARRDWPEPPSQEQQQRFISRFLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDFGRRSTEDAADAA
  • Signal peptide:  MKTKVFLGLILSAAVTACLC
  • Modification:  T30 Sulfotyrosine;T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A potent stimulus of avian gastric acid
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09859-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000904_AF2.pdbhor000904_ESM.pdb

Physical Information

Mass: 481815 Formula: C196H271N49O53S
Absent amino acids: CIT Common amino acids: F
pI: 4.69 Basic residues: 5
Polar residues: 6 Hydrophobic residues: 15
Hydrophobicity: -22.5 Boman Index: -4396
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 65
Instability Index: 1371.94 Extinction Coefficient cystines: 6990
Absorbance 280nm: 199.71

Literature

  • PubMed ID:  3743781
  • Title:  Isolation From Chicken Antrum, and Primary Amino Acid Sequence of a Novel 36-residue Peptide of the gastrin/CCK Family