General Information

  • ID:  hor000901
  • Uniprot ID:  Q9UBC7-2
  • Protein name:  alarin
  • Gene name:  GALP
  • Organism:  Homo sapiens (Human)
  • Family:  Galanin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with GALP include Ganglioneuroblastoma and Ganglioneuroma.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0035821 modulation of process of another organism; GO:0050829 defense response to Gram-negative bacterium; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
  • GO CC:  NA

Sequence Information

  • Sequence:  APAHRSSTFPKWVTKTERGRQPLRS
  • Length:  25(25-49)
  • Propeptide:  MAPPSVPLVLLLVLLLSLAETPASAPAHRSSTFPKWVTKTERGRQPLRS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exhibits antimicrobial activity against Gram-negative bacterias,
  • Mechanism:  Cleavage of the signal peptide generates a peptide of 25 amino acids, termed alarin because of the N-terminal alanine and the C-terminal serine. Involved in ganglionic differentiation in neuroblastic tumor tissues. Vasoactive peptide.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9UBC7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000901_AF2.pdbhor000901_ESM.pdb

Physical Information

Mass: 332252 Formula: C127H205N43O35
Absent amino acids: CDIMNY Common amino acids: R
pI: 12.52 Basic residues: 7
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: -128.8 Boman Index: -8687
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 35.2
Instability Index: 9773.6 Extinction Coefficient cystines: 5500
Absorbance 280nm: 229.17

Literature

  • PubMed ID:  23537644
  • Title:  Alarin but Not Its Alternative-Splicing Form, GALP (Galanin-like Peptide) Has Antimicrobial Activity