General Information

  • ID:  hor000900
  • Uniprot ID:  Q9UBC7
  • Protein name:  Galanin-like peptide
  • Gene name:  GALP
  • Organism:  Homo sapiens (Human)
  • Family:  Galanin family
  • Source:  Human
  • Expression:  Isoform 2 is found in ganglia of ganglioneuroma and ganglioneuroblastoma, as well as in differentiated tumor cells of neuroblastoma tissues. Not found in undifferentiated neuroblasts. Isoform 2 is found in the skin, in pericytes covering microvascular art
  • Disease:  Diseases associated with GALP include Ganglioneuroblastoma and Ganglioneuroma.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008150 biological_process; GO:0009725 response to hormone; GO:0032098 regulation of appetite; GO:0032868 response to insulin; GO:0042595 behavioral response to starvation; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
  • Length:  60(25-84)
  • Propeptide:  MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS
  • Signal peptide:  MAPPSVPLVLLLVLLLSLAETPAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
  • Mechanism:  [Isoform 2]: Cleavage of the signal peptide generates a peptide of 25 amino acids, termed alarin because of the N-terminal alanine and the C-terminal serine. Involved in ganglionic differentiation in neuroblastic tumor tissues. Vasoactive peptide.
  • Cross BBB:  NA
  • Target:  GALR2, GALR1
  • Target Unid:   O43603, P47211
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9UBC7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000900_AF2.pdbhor000900_ESM.pdb

Physical Information

Mass: 755295 Formula: C292H451N83O84S
Absent amino acids: CF Common amino acids: LG
pI: 6.8 Basic residues: 8
Polar residues: 16 Hydrophobic residues: 19
Hydrophobicity: -50.33 Boman Index: -7548
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 84.67
Instability Index: 5484.67 Extinction Coefficient cystines: 13980
Absorbance 280nm: 236.95

Literature

  • PubMed ID:  NA
  • Title:  NA