General Information

  • ID:  hor000888
  • Uniprot ID:  Q9W6M9
  • Protein name:  Galanin
  • Gene name:  GAL
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GWTLNSAGYLLGPHAVDNHRSFNDKHGFT
  • Length:  29(33-61)
  • Propeptide:  MQRCAGFLFLSLILCAALSETFGLVLSAKEKRGWTLNSAGYLLGPHAVDNHRSFNDKHGFTGKREIQPEEDIKAGNIGRPLADENIVRTVVEFLTYLHLKEAGALDNLPSPEETNES
  • Signal peptide:  MQRCAGFLFLSLILCAALS
  • Modification:  T29 Threonine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9W6M9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000888_AF2.pdbhor000888_ESM.pdb

Physical Information

Mass: 371211 Formula: C144H207N43O42
Absent amino acids: CEIMQ Common amino acids: G
pI: 7.8 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -65.86 Boman Index: -4942
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 57.24
Instability Index: 895.52 Extinction Coefficient cystines: 6990
Absorbance 280nm: 249.64

Literature

  • PubMed ID:  NA
  • Title:  NA