General Information

  • ID:  hor000886
  • Uniprot ID:  P11242
  • Protein name:  Galanin
  • Gene name:  GAL
  • Organism:  Bos taurus (Bovine)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031763 galanin receptor binding; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  GWTLNSAGYLLGPHALDSHRSFQDKHGLA
  • Length:  29(33-61)
  • Propeptide:  MPRGSVLLLASLLLAAALSATLGLGSPVKEKRGWTLNSAGYLLGPHALDSHRSFQDKHGLAGKRELEPEDEARPGSFDRPLAENNVVRTIIEFLTFLHLKDAGALERLPSLPTAESAEDAERS
  • Signal peptide:  MPRGSVLLLASLLLAAALS
  • Modification:  T29 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GALR1, GALR2
  • Target Unid:  E1BCM7, A6QLK3
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11242-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000886_AF2.pdbhor000886_ESM.pdb

Physical Information

Mass: 364911 Formula: C141H210N42O41
Absent amino acids: CEIMV Common amino acids: L
pI: 7.8 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -45.86 Boman Index: -3788
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 77.59
Instability Index: 2742.07 Extinction Coefficient cystines: 6990
Absorbance 280nm: 249.64

Literature

  • PubMed ID:  NA
  • Title:  NA