General Information

  • ID:  hor000875
  • Uniprot ID:  P09558
  • Protein name:  Big endothelin-1
  • Gene name:  EDN1
  • Organism:  Sus scrofa (Pig)
  • Family:  Endothelin/sarafotoxin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031707 endothelin A receptor binding; GO:0031708 endothelin B receptor binding
  • GO BP:  GO:0003100 regulation of systemic arterial blood pressure by endothelin; GO:0006874 intracellular calcium ion homeostasis; GO:0014826 vein smooth muscle contraction; GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0086100 endothelin receptor signaling pathway; GO:0097746 blood vessel diameter maintenance; GO:1900182 positive regulation of protein localization to nucleus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CSCSSLMDKECVYFCHLDIIWVNTPEHIVP
  • Length:  30(53-82)
  • Propeptide:  MDYFPMIIALLFVAFQGAPETAVLGAELSPEAESQGETPSPHASWRPRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRSRRSLKDLFPAKAADRRDRCQCASQKDKKCWSFCQAGKEIGRDQDTMEKRWDNQKKGTDCSKLGEKCIHRQLVMGRKIRRLEAISNSIKTSFHIAKLKAELYRDKKVTHNRTH
  • Signal peptide:  MDYFPMIIALLFVAFQGAPETAVLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  endothelium-derived vasoconstrictor peptides
  • Mechanism:  activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells
  • Cross BBB:  NA
  • Target:  EDNRB, EDNRA
  • Target Unid:  P35463, Q29010
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-15; 3-11
  • Structure ID:  AF-P09558-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000875_AF2.pdbhor000875_ESM.pdb

Physical Information

Mass: 400053 Formula: C154H233N37O45S5
Absent amino acids: AGQR Common amino acids: C
pI: 4.53 Basic residues: 3
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: 40.33 Boman Index: -1598
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 94
Instability Index: 6046.67 Extinction Coefficient cystines: 7240
Absorbance 280nm: 249.66

Literature

  • PubMed ID:  2665739
  • Title:  Presence of endothelin-1 in Porcine Spinal Cord: Isolation and Sequence Determination